PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016481927.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 314aa    MW: 34619.4 Da    PI: 10.3031
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016481927.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding383.9e-1295139347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I++    +Rt+ q+ s+ qky
   XP_016481927.1  95 SWTEEEHRSFLIGLEKLGKGDWRGISKSYVPTRTPSQVASHAQKY 139
                      7**************************9988*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.927621IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.0888144IPR017930Myb domain
SuperFamilySSF466898.22E-1790144IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-1691142IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.1E-1092138IPR009057Homeodomain-like
SMARTSM007171.1E-892142IPR001005SANT/Myb domain
CDDcd001672.08E-995140No hitNo description
PfamPF002492.0E-1095139IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MTKDARKCSH CGQNGHNSRT CNYNSKGIKL FGVRIDDTTN NNHHGDTKMK MKIGDHESAI  60
RRSKSLGNLE IHDHNAVLDS GYLSDGPRNR KKGTSWTEEE HRSFLIGLEK LGKGDWRGIS  120
KSYVPTRTPS QVASHAQKYF IRIASNDKKK RRPSVFDVNL KDSISQIPSE TYSSSPSISK  180
NMVPEVQKEA SAPLEQLFDT CQIKGQAAPC ARPPLSPMTR PLGVPDLRRM PCMMGVPRGL  240
TAAKVIAPTV SWVPVFNFPP NQSHLNYRFA PFVARPPTAG LLSHPPPHSQ VQSQPGHSTP  300
VTNNDGLNIC IGAL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147151KKKRR
2147152KKKRRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00573DAPTransfer from AT5G61620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778274.10.0PREDICTED: transcription factor MYB1R1-like
RefseqXP_016481927.10.0PREDICTED: transcription factor MYB1R1-like
TrEMBLK4C4M71e-134K4C4M7_SOLLC; Uncharacterized protein
STRINGSolyc06g034030.2.11e-133(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117831823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.11e-50MYB_related family protein